PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0077969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 190aa    MW: 21062.2 Da    PI: 4.8029
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0077969.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.51e-42201191100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Lj0g3v0077969.1  20 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEAGARIRDPVYGCAGAICQLQKQVNELQAQL 113
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Lj0g3v0077969.1 114 AKAHAE 119
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.15319120IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4220117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MESDTVTNTS PISPQVVMSP CAACKILRRR CAEKCVLAPY FPPTEPAKFT IAHRVFGASN  60
IIKFLQELPE SQRADAVTSM VYEAGARIRD PVYGCAGAIC QLQKQVNELQ AQLAKAHAEL  120
VNMQLQQANL MALICMEKMV ETPMQESPPQ KSVDNFFISS PSSSSDYQND LNFFEENITG  180
LNSLWEPLLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971751e-116BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542002.11e-108PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK082e-78LBD11_ARATH; LOB domain-containing protein 11
TrEMBLK7M3861e-108K7M386_SOYBN; Uncharacterized protein
STRINGGLYMA13G40370.21e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-76LOB domain-containing protein 11